Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) |
Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins) |
Protein Cre recombinase [56355] (1 species) |
Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries) Uniprot P06956 20-341 |
Domain d1q3vf2: 1q3v F:130-341 [95767] Other proteins in same PDB: d1q3va1, d1q3vb1, d1q3ve1, d1q3vf1 protein/DNA complex; complexed with iod, mg |
PDB Entry: 1q3v (more details), 2.91 Å
SCOPe Domain Sequences for d1q3vf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3vf2 d.163.1.1 (F:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]} rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei mqaggwtnvnivmnyirnldsetgamvrlled
Timeline for d1q3vf2: