Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) |
Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein) |
Protein Thermosome, A-domain [52035] (4 species) |
Species Archaeon Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102202] (4 PDB entries) |
Domain d1q3sd2: 1q3s D:217-369 [95738] Other proteins in same PDB: d1q3sa1, d1q3sa3, d1q3sb1, d1q3sb3, d1q3sc1, d1q3sc3, d1q3sd1, d1q3sd3, d1q3se1, d1q3se3, d1q3sf1, d1q3sf3, d1q3sg1, d1q3sg3, d1q3sh1, d1q3sh3 |
PDB Entry: 1q3s (more details), 3 Å
SCOP Domain Sequences for d1q3sd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3sd2 c.8.5.2 (D:217-369) Thermosome, A-domain {Archaeon Thermococcus sp. ks-1, alpha chain} rgvvidkevvhprmpkrvenakialinealevkktetdakinitspdqlmsfleqeekml kdmvdhiaqtganvvfvqkgiddlaqhylakygimavrrvkksdmeklakatgakivtnv kdltpedlgyaevveerklagenmifvegcknp
Timeline for d1q3sd2: