Lineage for d1q3sf3 (1q3s F:146-216,F:370-405)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603057Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 603058Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 603208Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)
  6. 603209Protein Thermosome, I domain [54854] (3 species)
  7. 603210Species Archaeon Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102951] (4 PDB entries)
  8. 603228Domain d1q3sf3: 1q3s F:146-216,F:370-405 [95745]
    Other proteins in same PDB: d1q3sa1, d1q3sa2, d1q3sb1, d1q3sb2, d1q3sc1, d1q3sc2, d1q3sd1, d1q3sd2, d1q3se1, d1q3se2, d1q3sf1, d1q3sf2, d1q3sg1, d1q3sg2, d1q3sh1, d1q3sh2

Details for d1q3sf3

PDB Entry: 1q3s (more details), 3 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (formiii crystal complexed with adp)

SCOP Domain Sequences for d1q3sf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3sf3 d.56.1.2 (F:146-216,F:370-405) Thermosome, I domain {Archaeon Thermococcus sp. ks-1, alpha chain}
vdpddeetllkiaatsitgknaeshkellaklaveavkqvaekkdgkyvvdldnikfekk
agegveeselvXkavtilirggtehvideveraledavkvvkdvmedg

SCOP Domain Coordinates for d1q3sf3:

Click to download the PDB-style file with coordinates for d1q3sf3.
(The format of our PDB-style files is described here.)

Timeline for d1q3sf3: