SCOP 1.69: Domain d1q3oa_: 1q3o A:

Lineage for d1q3oa_ (1q3o A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (29 proteins)
   Pfam 00595

6. Protein Shank1, PDZ domain [101733] (1 species)
   SH3 and multiple ankyrin repeat domains protein 1

7. Species Rat (Rattus norvegicus) [TaxId:10116] [101734] (2 PDB entries)

8. Domain d1q3oa_: 1q3o A: [95700]

Details for d1q3oa_

PDB Entry: 1q3o, 1.8 Å

PDB Description: Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization

SCOP Domain Sequences for d1q3oa_:

Sequence; same for both SEQRES and ATOM records:

>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus)}
dyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawrag
lrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrh

Timeline for d1q3oa_:

• d1q3oa_ first appeared in SCOP 1.67
  
• d1q3oa_ appears in SCOP 1.71
  
• d1q3oa_ appears in the current release, SCOPe 2.08