Lineage for d1q3oa_ (1q3o A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373409Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 373410Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 373411Family b.36.1.1: PDZ domain [50157] (24 proteins)
  6. 373498Protein Shank1, PDZ domain [101733] (1 species)
    SH3 and multiple ankyrin repeat domains protein 1
  7. 373499Species Rat (Rattus norvegicus) [TaxId:10116] [101734] (2 PDB entries)
  8. 373500Domain d1q3oa_: 1q3o A: [95700]

Details for d1q3oa_

PDB Entry: 1q3o (more details), 1.8 Å

PDB Description: Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization

SCOP Domain Sequences for d1q3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus)}
dyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawrag
lrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrh

SCOP Domain Coordinates for d1q3oa_:

Click to download the PDB-style file with coordinates for d1q3oa_.
(The format of our PDB-style files is described here.)

Timeline for d1q3oa_: