Lineage for d1q3oa_ (1q3o A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786102Protein Shank1, PDZ domain [101733] (2 species)
    SH3 and multiple ankyrin repeat domains protein 1
  7. 2786108Species Norway rat (Rattus norvegicus) [TaxId:10116] [101734] (5 PDB entries)
  8. 2786109Domain d1q3oa_: 1q3o A: [95700]
    complexed with br

Details for d1q3oa_

PDB Entry: 1q3o (more details), 1.8 Å

PDB Description: Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization
PDB Compounds: (A:) Shank1

SCOPe Domain Sequences for d1q3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawrag
lrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrh

SCOPe Domain Coordinates for d1q3oa_:

Click to download the PDB-style file with coordinates for d1q3oa_.
(The format of our PDB-style files is described here.)

Timeline for d1q3oa_: