Lineage for d1q3kb_ (1q3k B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1631073Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1631074Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 1631075Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 1631076Protein Creatininase [102217] (1 species)
  7. 1631077Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 1631109Domain d1q3kb_: 1q3k B: [95694]
    complexed with gol, zn

Details for d1q3kb_

PDB Entry: 1q3k (more details), 2.1 Å

PDB Description: crystal structure of creatinine amidohydrolase (creatininase)
PDB Compounds: (B:) creatininase

SCOPe Domain Sequences for d1q3kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3kb_ c.125.1.1 (B:) Creatininase {Pseudomonas putida [TaxId: 303]}
sksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavcqrvaerig
alvlpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgvrrlvlmnghy
ensmfivegidlalrelryagihdfkvvvlsywdfvkdpaviqrlypegflgwdiehggv
fetslmlalypdlvdlervvdhppatfppydvfpvdpartpapgtlssaktasrekgeli
levcvqgiadaigqefppt

SCOPe Domain Coordinates for d1q3kb_:

Click to download the PDB-style file with coordinates for d1q3kb_.
(The format of our PDB-style files is described here.)

Timeline for d1q3kb_: