SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1q3kb_ (1q3k B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151348Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2151349Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 2151350Family c.125.1.1: Creatininase [102216] (2 protein domains)
  6. 2151351Protein Creatininase [102217] (1 species)
  7. 2151352Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 2151384Domain d1q3kb_: 1q3k B: [95694]
    complexed with gol, zn

Details for d1q3kb_

PDB Entry: 1q3k (more details), 2.1 Å

PDB Description: Crystal structure of creatinine amidohydrolase (creatininase)
PDB Compounds: (B:) creatininase

SCOPe Domain Sequences for d1q3kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3kb_ c.125.1.1 (B:) Creatininase {Pseudomonas putida [TaxId: 303]}
sksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavcqrvaerig
alvlpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgvrrlvlmnghy
ensmfivegidlalrelryagihdfkvvvlsywdfvkdpaviqrlypegflgwdiehggv
fetslmlalypdlvdlervvdhppatfppydvfpvdpartpapgtlssaktasrekgeli
levcvqgiadaigqefppt

SCOPe Domain Coordinates for d1q3kb_:

Click to download the PDB-style file with coordinates for d1q3kb_.
(The format of our PDB-style files is described here.)

Timeline for d1q3kb_: