SCOPe 2.02: Domain d1q38a_: 1q38 A:

Lineage for d1q38a_ (1q38 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Fibronectin, different Fn3 modules [49270] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries)

8. Domain d1q38a_: 1q38 A: [95663]
   anastellin, a fragment of the first Fn3 module

Details for d1q38a_

PDB Entry: 1q38

PDB Description: anastellin

PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1q38a_:

Sequence; same for both SEQRES and ATOM records:

>d1q38a_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}
mrgsnapqpshiskyilrwrpknsvgrwkeatipghlnsytikglkpgvvyegqlisiqq
yghqevtrfdftttststpgsrshhhhhh

Timeline for d1q38a_:

• d1q38a_ first appeared in SCOP 1.67
  
• d1q38a_ appears in SCOPe 2.01
  
• d1q38a_ appears in SCOPe 2.03
  
• d1q38a_ appears in the current release, SCOPe 2.08, called d1q38a1