Lineage for d1q38a_ (1q38 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1297328Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1297329Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1297517Protein Fibronectin, different Fn3 modules [49270] (3 species)
  7. 1297520Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries)
  8. 1297531Domain d1q38a_: 1q38 A: [95663]
    anastellin, a fragment of the first Fn3 module

Details for d1q38a_

PDB Entry: 1q38 (more details)

PDB Description: anastellin
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1q38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q38a_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}
mrgsnapqpshiskyilrwrpknsvgrwkeatipghlnsytikglkpgvvyegqlisiqq
yghqevtrfdftttststpgsrshhhhhh

SCOPe Domain Coordinates for d1q38a_:

Click to download the PDB-style file with coordinates for d1q38a_.
(The format of our PDB-style files is described here.)

Timeline for d1q38a_: