SCOPe 2.02: Domain d1q2eb_: 1q2e B:

Lineage for d1q2eb_ (1q2e B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold

6. Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)

7. Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (11 PDB entries)

8. Domain d1q2eb_: 1q2e B: [95626]
   complexed with ca, nag

Details for d1q2eb_

PDB Entry: 1q2e, 1.75 Å

PDB Description: cellobiohydrolase cel7a with loop deletion 245-252 and bound non- hydrolysable cellotetraose

PDB Compounds: (B:) exocellobiohydrolase I

SCOPe Domain Sequences for d1q2eb_:

Sequence; same for both SEQRES and ATOM records:

>d1q2eb_ b.29.1.10 (B:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
dgcgggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgainryyvqng
vtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggmvlvmslwd
dyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsnikfgpigs
tgnpsg

Timeline for d1q2eb_:

• d1q2eb_ first appeared in SCOP 1.67
  
• d1q2eb_ appears in SCOPe 2.01
  
• d1q2eb_ appears in SCOPe 2.03
  
• d1q2eb_ appears in the current release, SCOPe 2.08