Lineage for d1q2eb_ (1q2e B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779929Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species)
  7. 2779962Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (22 PDB entries)
  8. 2779974Domain d1q2eb_: 1q2e B: [95626]
    complexed with ca, nag

Details for d1q2eb_

PDB Entry: 1q2e (more details), 1.75 Å

PDB Description: cellobiohydrolase cel7a with loop deletion 245-252 and bound non- hydrolysable cellotetraose
PDB Compounds: (B:) exocellobiohydrolase I

SCOPe Domain Sequences for d1q2eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2eb_ b.29.1.10 (B:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
dgcgggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgainryyvqng
vtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggmvlvmslwd
dyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsnikfgpigs
tgnpsg

SCOPe Domain Coordinates for d1q2eb_:

Click to download the PDB-style file with coordinates for d1q2eb_.
(The format of our PDB-style files is described here.)

Timeline for d1q2eb_: