Lineage for d1q2ba_ (1q2b A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119246Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
  6. 1119247Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)
  7. 1119276Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (11 PDB entries)
  8. 1119277Domain d1q2ba_: 1q2b A: [95624]
    complexed with co, nag; mutant

Details for d1q2ba_

PDB Entry: 1q2b (more details), 1.6 Å

PDB Description: cellobiohydrolase cel7a with disulphide bridge added across exo-loop by mutations d241c and d249c
PDB Compounds: (A:) exocellobiohydrolase I

SCOPe Domain Sequences for d1q2ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2ba_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
cgcggtyscnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOPe Domain Coordinates for d1q2ba_:

Click to download the PDB-style file with coordinates for d1q2ba_.
(The format of our PDB-style files is described here.)

Timeline for d1q2ba_: