Lineage for d1q2ba_ (1q2b A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371784Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (1 protein)
    contains many insertions in the common fold
  6. 371785Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (5 species)
  7. 371812Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (11 PDB entries)
  8. 371813Domain d1q2ba_: 1q2b A: [95624]
    complexed with co, nag; mutant

Details for d1q2ba_

PDB Entry: 1q2b (more details), 1.6 Å

PDB Description: cellobiohydrolase cel7a with disulphide bridge added across exo-loop by mutations d241c and d249c

SCOP Domain Sequences for d1q2ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2ba_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
cgcggtyscnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOP Domain Coordinates for d1q2ba_:

Click to download the PDB-style file with coordinates for d1q2ba_.
(The format of our PDB-style files is described here.)

Timeline for d1q2ba_: