![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Putidaredoxin reductase, N- and C-terminal domain [418952] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [419408] (2 PDB entries) |
![]() | Domain d1q1wa1: 1q1w A:2-114,A:248-319 [95609] Other proteins in same PDB: d1q1wa2, d1q1wa3, d1q1wa4, d1q1wb2, d1q1wb3, d1q1wb4 complexed with fad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1q1w (more details), 2.6 Å
SCOPe Domain Sequences for d1q1wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1wa1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase, N- and C-terminal domain {Pseudomonas putida [TaxId: 303]} nandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkataes lylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrpXlipnce lasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvriesvpnaleqarkia ailcgk
Timeline for d1q1wa1:
![]() Domains from other chains: (mouse over for more information) d1q1wb1, d1q1wb2, d1q1wb3, d1q1wb4 |