Lineage for d1q1wa3 (1q1w A:320-422)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. Protein Putidaredoxin reductase [103115] (1 species)
  7. Species Pseudomonas putida [TaxId:303] [103116] (2 PDB entries)
  8. Domain d1q1wa3: 1q1w A:320-422 [95611]
    Other proteins in same PDB: d1q1wa1, d1q1wa2, d1q1wa4, d1q1wb1, d1q1wb2, d1q1wb4
    complexed with fad

Details for d1q1wa3

PDB Entry: 1q1w (more details), 2.6 Å

PDB Description: Crystal Structure of Putidaredoxin Reductase from Pseudomonas putida
PDB Compounds: (A:) Putidaredoxin reductase

SCOPe Domain Sequences for d1q1wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1wa3 d.87.1.1 (A:320-422) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}
vprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpdfsvfylqgdrvlavdtvnr
pvefnqskqiitdrlpvepnllgdesvplkeiiaaakaelssa

SCOPe Domain Coordinates for d1q1wa3 are not available.

Timeline for d1q1wa3:

Domains from same chain:
(mouse over for more information)
d1q1wa1, d1q1wa2, d1q1wa4
Domains from other chains:
(mouse over for more information)
d1q1wb1, d1q1wb2, d1q1wb3, d1q1wb4