Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species) there is an additional C-terminal allosteric domain in some species |
Species Escherichia coli [TaxId:562] [102698] (2 PDB entries) |
Domain d1q1ka1: 1q1k A:5-224 [95589] Other proteins in same PDB: d1q1ka2 complexed with prt, tla |
PDB Entry: 1q1k (more details), 2.9 Å
SCOPe Domain Sequences for d1q1ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1ka1 c.94.1.1 (A:5-224) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Escherichia coli [TaxId: 562]} trlriamqksgrlsddsrellarcgikinlhtqrliamaenmpidilrvrdddipglvmd gvvdlgiigenvleeellnrraqgedpryftlrrldfggcrlslatpvdeawdgplslng kriatsyphllkryldqkgisfkscllngsvevapragladaicdlvstgatleanglre veviyrskacliqrdgemeeskqqlidklltriqgviqar
Timeline for d1q1ka1: