SCOPe 2.08: Domain d1q1ka1: 1q1k A:5-224

Lineage for d1q1ka1 (1q1k A:5-224)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species)
   there is an additional C-terminal allosteric domain in some species

7. Species Escherichia coli [TaxId:562] [102698] (2 PDB entries)

8. Domain d1q1ka1: 1q1k A:5-224 [95589]
   Other proteins in same PDB: d1q1ka2
   complexed with prt, tla

Details for d1q1ka1

PDB Entry: 1q1k, 2.9 Å

PDB Description: structure of atp-phosphoribosyltransferase from e. coli complexed with pr-atp

PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d1q1ka1:

Sequence; same for both SEQRES and ATOM records:

>d1q1ka1 c.94.1.1 (A:5-224) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Escherichia coli [TaxId: 562]}
trlriamqksgrlsddsrellarcgikinlhtqrliamaenmpidilrvrdddipglvmd
gvvdlgiigenvleeellnrraqgedpryftlrrldfggcrlslatpvdeawdgplslng
kriatsyphllkryldqkgisfkscllngsvevapragladaicdlvstgatleanglre
veviyrskacliqrdgemeeskqqlidklltriqgviqar

Timeline for d1q1ka1:

• d1q1ka1 first appeared in SCOP 1.67
  
• d1q1ka1 appears in SCOPe 2.07