Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.3: ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [88851] (1 protein) automatically mapped to Pfam PF08029 |
Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [82669] (2 species) binds allosteric inhibitor histidine |
Species Escherichia coli [TaxId:562] [102977] (2 PDB entries) |
Domain d1q1ka2: 1q1k A:225-299 [95590] Other proteins in same PDB: d1q1ka1 complexed with prt, tla |
PDB Entry: 1q1k (more details), 2.9 Å
SCOPe Domain Sequences for d1q1ka2:
Sequence, based on SEQRES records: (download)
>d1q1ka2 d.58.5.3 (A:225-299) ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain {Escherichia coli [TaxId: 562]} eskyimmhapterldeviallpgaerptilplagdqqrvamhmvssetlfwetmeklkal gassilvlpiekmme
>d1q1ka2 d.58.5.3 (A:225-299) ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain {Escherichia coli [TaxId: 562]} eskyimmhapterldeviallpgaerptilplamhmvssetlfwetmeklkalgassilv lpiekmme
Timeline for d1q1ka2: