Class j: Peptides [58231] (151 folds) |
Fold j.105: Ubiquitin interacting motif (UIM) [90302] (1 superfamily) |
Superfamily j.105.1: Ubiquitin interacting motif (UIM) [90303] (1 family) |
Family j.105.1.1: Ubiquitin interacting motif (UIM) [90304] (2 proteins) amphipathic helix |
Protein Vacuolar protein sorting-associated protein vps27p [90305] (1 species) |
Species Synthetic, based on yeast sequence [90306] (3 PDB entries) |
Domain d1q0va_: 1q0v A: [95514] tandem repeat of two UIMs |
PDB Entry: 1q0v (more details)
SCOPe Domain Sequences for d1q0va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q0va_ j.105.1.1 (A:) Vacuolar protein sorting-associated protein vps27p {Synthetic, based on yeast sequence} mdrdystpedeeelirkaielslkesrnsassepivpvvesknevkrqeieeeedpdlka aiqeslreaeeaklrserqka
Timeline for d1q0va_: