SCOPe 2.08: Domain d1q0va_: 1q0v A:

Lineage for d1q0va_ (1q0v A:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.105: Ubiquitin interacting motif (UIM) [90302] (1 superfamily)

4. Superfamily j.105.1: Ubiquitin interacting motif (UIM) [90303] (1 family)

5. Family j.105.1.1: Ubiquitin interacting motif (UIM) [90304] (2 proteins)
   amphipathic helix

6. Protein Vacuolar protein sorting-associated protein vps27p [90305] (1 species)

7. Species Synthetic, based on yeast sequence [90306] (3 PDB entries)

8. Domain d1q0va_: 1q0v A: [95514]
   tandem repeat of two UIMs

Details for d1q0va_

PDB Entry: 1q0v

PDB Description: solution structure of tandem uims of vps27

PDB Compounds: (A:) hydrophilic protein; has cysteine rich putative zinc finger esential for function; Vps27p

SCOPe Domain Sequences for d1q0va_:

Sequence; same for both SEQRES and ATOM records:

>d1q0va_ j.105.1.1 (A:) Vacuolar protein sorting-associated protein vps27p {Synthetic, based on yeast sequence}
mdrdystpedeeelirkaielslkesrnsassepivpvvesknevkrqeieeeedpdlka
aiqeslreaeeaklrserqka

Timeline for d1q0va_:

• d1q0va_ first appeared in SCOP 1.67
  
• d1q0va_ appears in SCOPe 2.07