PDB entry 1q0v

View 1q0v on RCSB PDB site
Description: Solution Structure of Tandem UIMs of Vps27
Class: transport binding
Keywords: Stable, non-interacting alpha-helices, TRANSPORT BINDING
Deposited on 2003-07-17, released 2003-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hydrophilic protein; has cysteine rich putative zinc finger esential for function; Vps27p
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: vps27
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40343 (0-80)
    • initiating met (0)
  Domains in SCOPe 2.08: d1q0va_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q0vA (A:)
  mdrdystpedeeelirkaielslkesrnsassepivpvvesknevkrqeieeeedpdlka
  aiqeslreaeeaklrserqka