Class a: All alpha proteins [46456] (202 folds) |
Fold a.34: Dimerisation interlock [47405] (3 superfamilies) 4 helices; bundle, closed, right-handed twist |
Superfamily a.34.3: Docking domain A of the erythromycin polyketide synthase (DEBS) [101166] (1 family) |
Family a.34.3.1: Docking domain A of the erythromycin polyketide synthase (DEBS) [101167] (1 protein) |
Protein Erythronolide synthase [101168] (1 species) |
Species Saccharopolyspora erythraea [TaxId:1836] [101169] (1 PDB entry) |
Domain d1pzqa_: 1pzq A: [95466] |
PDB Entry: 1pzq (more details)
SCOP Domain Sequences for d1pzqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzqa_ a.34.3.1 (A:) Erythronolide synthase {Saccharopolyspora erythraea} gsaaspavdigdrldelekalealsaedghddvgqrlesllrrwnsrradapstsaised
Timeline for d1pzqa_: