SCOP 1.67: Domain d1pzqa_: 1pzq A:

Lineage for d1pzqa_ (1pzq A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.34: Dimerisation interlock [47405] (3 superfamilies)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.34.3: Docking domain A of the erythromycin polyketide synthase (DEBS) [101166] (1 family)

5. Family a.34.3.1: Docking domain A of the erythromycin polyketide synthase (DEBS) [101167] (1 protein)

6. Protein Erythronolide synthase [101168] (1 species)

7. Species Saccharopolyspora erythraea [TaxId:1836] [101169] (1 PDB entry)

8. Domain d1pzqa_: 1pzq A: [95466]

Details for d1pzqa_

PDB Entry: 1pzq

PDB Description: structure of fused docking domains from the erythromycin polyketide synthase (debs), a model for the interaction between debs 2 and debs 3: the a domain

SCOP Domain Sequences for d1pzqa_:

Sequence; same for both SEQRES and ATOM records:

>d1pzqa_ a.34.3.1 (A:) Erythronolide synthase {Saccharopolyspora erythraea}
gsaaspavdigdrldelekalealsaedghddvgqrlesllrrwnsrradapstsaised

Timeline for d1pzqa_:

• d1pzqa_ is new in SCOP 1.67
  
• d1pzqa_ appears in SCOP 1.69
  
• d1pzqa_ appears in the current release, SCOPe 2.08, called d1pzqa1