PDB entry 1pzq

View 1pzq on RCSB PDB site
Description: structure of fused docking domains from the erythromycin polyketide synthase (debs), a model for the interaction between debs 2 and debs 3: the a domain
Deposited on 2003-07-14, released 2004-02-24
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: NMR8
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pzqa_
  • Chain 'B':
    Domains in SCOP 1.67: d1pzqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzqA (A:)
    gsaaspavdigdrldelekalealsaedghddvgqrlesllrrwnsrradapstsaised
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzqB (B:)
    gsaaspavdigdrldelekalealsaedghddvgqrlesllrrwnsrradapstsaised