Lineage for d1pzpa_ (1pzp A:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 423760Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 423761Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 423762Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (10 proteins)
  6. 423845Protein beta-Lactamase, class A [56606] (15 species)
  7. 423860Species Escherichia coli, TEM-1 [TaxId:562] [56607] (28 PDB entries)
  8. 423864Domain d1pzpa_: 1pzp A: [95465]
    complexed with fta; mutant

Details for d1pzpa_

PDB Entry: 1pzp (more details), 1.45 Å

PDB Description: tem-1 beta-lactamase in complex with a novel, core-disrupting, allosteric inhibitor

SCOP Domain Sequences for d1pzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzpa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqrdlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOP Domain Coordinates for d1pzpa_:

Click to download the PDB-style file with coordinates for d1pzpa_.
(The format of our PDB-style files is described here.)

Timeline for d1pzpa_: