Lineage for d1pzhc1 (1pzh C:14-163)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579075Protein Lactate dehydrogenase [51859] (18 species)
  7. 1579241Species Toxoplasma gondii [TaxId:5811] [102166] (5 PDB entries)
  8. 1579248Domain d1pzhc1: 1pzh C:14-163 [95437]
    Other proteins in same PDB: d1pzha2, d1pzhb2, d1pzhc2, d1pzhd2
    complexed with nad, oxl

Details for d1pzhc1

PDB Entry: 1pzh (more details), 1.9 Å

PDB Description: T.gondii LDH1 ternary complex with NAD and oxalate
PDB Compounds: (C:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzhc1 c.2.1.5 (C:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

SCOPe Domain Coordinates for d1pzhc1:

Click to download the PDB-style file with coordinates for d1pzhc1.
(The format of our PDB-style files is described here.)

Timeline for d1pzhc1: