SCOP 1.69: Domain d1pz5a1: 1pz5 A:1-107

Lineage for d1pz5a1 (1pz5 A:1-107)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)

8. Domain d1pz5a1: 1pz5 A:1-107 [95401]
   Other proteins in same PDB: d1pz5a2, d1pz5b1, d1pz5b2
   part of Fab Sya/J6

Details for d1pz5a1

PDB Entry: 1pz5, 1.8 Å

PDB Description: Structural basis of peptide-carbohydrate mimicry in an antibody combining site

SCOP Domain Sequences for d1pz5a1:

Sequence; same for both SEQRES and ATOM records:

>d1pz5a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvltqtplslpvrlgdqasiscrssqsllhsdgntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqtthvptfgggtkleik

Timeline for d1pz5a1:

• d1pz5a1 first appeared in SCOP 1.67
  
• d1pz5a1 appears in SCOP 1.71
  
• d1pz5a1 appears in the current release, SCOPe 2.08