PDB entry 1pz5

View 1pz5 on RCSB PDB site
Description: Structural basis of peptide-carbohydrate mimicry in an antibody combining site
Deposited on 2003-07-09, released 2003-11-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pz5A (A:)
    dvvltqtplslpvrlgdqasiscrssqsllhsdgntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqtthvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pz5B (B:)
    evkveesggglvqpggsmklscvasgftfsnywmewvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctrggavgamdywgqgtsvtvss
    atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
    fyslsslvtvpsstwpsqtvicnvahpaskvdlikeisgp