Lineage for d1pz1a_ (1pz1 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568069Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1568070Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1568309Protein Putative oxidoreductase YhdN [102056] (1 species)
    General stress protein 69, GSP69, AKR11B
  7. 1568310Species Bacillus subtilis [TaxId:1423] [102057] (1 PDB entry)
  8. 1568311Domain d1pz1a_: 1pz1 A: [95390]
    complexed with nap

Details for d1pz1a_

PDB Entry: 1pz1 (more details), 2.2 Å

PDB Description: Structure of NADPH-dependent family 11 aldo-keto reductase AKR11B(holo)
PDB Compounds: (A:) General stress protein 69

SCOPe Domain Sequences for d1pz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]}
meytsiadtgieasriglgtwaiggtmwggtdektsietiraaldqgitlidtapaygfg
qseeivgkaikeymkrdqvilatktaldwknnqlfrhanrariveevenslkrlqtdyid
lyqvhwpdplvpieetaevmkelydagkiraigvsnfsieqmdtfravaplhtiqppynl
feremeesvlpyakdnkittllygslcrglltgkmteeytfegddlrnhdpkfqkprfke
ylsavnqldklaktrygksvihlavrwildqpgadialwgarkpgqlealseitgwtlns
edqkdintilentisdpvgpefmapptreeipg

SCOPe Domain Coordinates for d1pz1a_:

Click to download the PDB-style file with coordinates for d1pz1a_.
(The format of our PDB-style files is described here.)

Timeline for d1pz1a_: