![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
![]() | Protein Putative oxidoreductase YhdN [102056] (1 species) General stress protein 69, GSP69, AKR11B |
![]() | Species Bacillus subtilis [TaxId:1423] [102057] (1 PDB entry) |
![]() | Domain d1pz1a1: 1pz1 A:1-331 [95390] Other proteins in same PDB: d1pz1a2, d1pz1b2 complexed with nap |
PDB Entry: 1pz1 (more details), 2.2 Å
SCOPe Domain Sequences for d1pz1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pz1a1 c.1.7.1 (A:1-331) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} meytsiadtgieasriglgtwaiggtmwggtdektsietiraaldqgitlidtapaygfg qseeivgkaikeymkrdqvilatktaldwknnqlfrhanrariveevenslkrlqtdyid lyqvhwpdplvpieetaevmkelydagkiraigvsnfsieqmdtfravaplhtiqppynl feremeesvlpyakdnkittllygslcrglltgkmteeytfegddlrnhdpkfqkprfke ylsavnqldklaktrygksvihlavrwildqpgadialwgarkpgqlealseitgwtlns edqkdintilentisdpvgpefmapptreei
Timeline for d1pz1a1: