Lineage for d1pyya4 (1pyy A:264-631)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054903Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)
  7. 1054904Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56625] (10 PDB entries)
  8. 1054906Domain d1pyya4: 1pyy A:264-631 [95388]
    Other proteins in same PDB: d1pyya1, d1pyya2, d1pyya3
    complexed with mpd, osu, so4; mutant

Details for d1pyya4

PDB Entry: 1pyy (more details), 2.42 Å

PDB Description: double mutant pbp2x t338a/m339f from streptococcus pneumoniae strain r6 at 2.4 a resolution
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d1pyya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyya4 e.3.1.1 (A:264-631) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgsafkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv
skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv
gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdslnlqtt
akaleqvs

SCOPe Domain Coordinates for d1pyya4:

Click to download the PDB-style file with coordinates for d1pyya4.
(The format of our PDB-style files is described here.)

Timeline for d1pyya4: