SCOPe 2.08: Domain d1pyya4: 1pyy A:264-631

Lineage for d1pyya4 (1pyy A:264-631)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56625] (10 PDB entries)

8. Domain d1pyya4: 1pyy A:264-631 [95388]
   Other proteins in same PDB: d1pyya1, d1pyya2, d1pyya3
   complexed with mpd, so4; mutant

Details for d1pyya4

PDB Entry: 1pyy, 2.42 Å

PDB Description: double mutant pbp2x t338a/m339f from streptococcus pneumoniae strain r6 at 2.4 a resolution

PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d1pyya4:

Sequence; same for both SEQRES and ATOM records:

>d1pyya4 e.3.1.1 (A:264-631) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgsafkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv
skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv
gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdslnlqtt
akaleqvs

Timeline for d1pyya4:

• d1pyya4 first appeared in SCOP 1.67
  
• d1pyya4 appears in SCOPe 2.07