![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Beta-D-xylosidase, catalytic domain [102077] (2 species) glycosyl hydrolase family 39 |
![]() | Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [102078] (2 PDB entries) |
![]() | Domain d1px8b2: 1px8 B:14-359 [95284] Other proteins in same PDB: d1px8a1, d1px8b1 complexed with xyp |
PDB Entry: 1px8 (more details), 2.4 Å
SCOPe Domain Sequences for d1px8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px8b2 c.1.8.3 (B:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} fsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcddvgiyredvvgdev kpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegnvtppkdyekwsdl vkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklykvtakaikevnenl kvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytphliyqeimpseyml nefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiarilseggdyvdsfs ywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamge
Timeline for d1px8b2: