SCOPe 2.08: Domain d1px8b2: 1px8 B:14-359

Lineage for d1px8b2 (1px8 B:14-359)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
   glycosyl hydrolase family 39

7. Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [102078] (2 PDB entries)

8. Domain d1px8b2: 1px8 B:14-359 [95284]
   Other proteins in same PDB: d1px8a1, d1px8b1
   complexed with xyp

Details for d1px8b2

PDB Entry: 1px8, 2.4 Å

PDB Description: crystal structure of beta-d-xylosidase from thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase

PDB Compounds: (B:) beta-xylosidase

SCOPe Domain Sequences for d1px8b2:

Sequence; same for both SEQRES and ATOM records:

>d1px8b2 c.1.8.3 (B:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]}
fsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcddvgiyredvvgdev
kpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegnvtppkdyekwsdl
vkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklykvtakaikevnenl
kvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytphliyqeimpseyml
nefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiarilseggdyvdsfs
ywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamge

Timeline for d1px8b2:

• d1px8b2 first appeared in SCOP 1.67
  
• d1px8b2 appears in SCOPe 2.07