Lineage for d1pwvb2 (1pwv B:551-776)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661589Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
    automatically mapped to Pfam PF07737
  6. 1661590Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
    duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain
  7. 1661591Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries)
  8. 1661612Domain d1pwvb2: 1pwv B:551-776 [95254]
    Other proteins in same PDB: d1pwva3, d1pwvb3
    complexed with an optimized peptide substrate (chains C and D) in the presence of zinc

Details for d1pwvb2

PDB Entry: 1pwv (more details), 2.85 Å

PDB Description: Crystal structure of Anthrax Lethal Factor wild-type protein complexed with an optimised peptide substrate.
PDB Compounds: (B:) Lethal Factor

SCOPe Domain Sequences for d1pwvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwvb2 d.92.1.14 (B:551-776) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

SCOPe Domain Coordinates for d1pwvb2:

Click to download the PDB-style file with coordinates for d1pwvb2.
(The format of our PDB-style files is described here.)

Timeline for d1pwvb2: