| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (26 proteins) Pfam 00059 |
| Protein Surfactant protein, lectin domain [56461] (2 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (3 PDB entries) |
| Domain d1pw9b1: 1pw9 B:235-355 [95207] Other proteins in same PDB: d1pw9a2, d1pw9b2, d1pw9c2 |
PDB Entry: 1pw9 (more details), 1.6 Å
SCOP Domain Sequences for d1pw9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pw9b1 d.169.1.1 (B:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f
Timeline for d1pw9b1:
View in 3DDomains from other chains: (mouse over for more information) d1pw9a1, d1pw9a2, d1pw9c1, d1pw9c2 |