Lineage for d1pw9b1 (1pw9 B:235-355)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421327Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 421328Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 421329Family d.169.1.1: C-type lectin domain [56437] (22 proteins)
  6. 421599Protein Surfactant protein, lectin domain [56461] (2 species)
  7. 421600Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (3 PDB entries)
  8. 421605Domain d1pw9b1: 1pw9 B:235-355 [95207]
    Other proteins in same PDB: d1pw9a2, d1pw9b2, d1pw9c2

Details for d1pw9b1

PDB Entry: 1pw9 (more details), 1.6 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d

SCOP Domain Sequences for d1pw9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pw9b1 d.169.1.1 (B:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOP Domain Coordinates for d1pw9b1:

Click to download the PDB-style file with coordinates for d1pw9b1.
(The format of our PDB-style files is described here.)

Timeline for d1pw9b1: