SCOP 1.67: Domain d1pw9c1: 1pw9 C:235-355

Lineage for d1pw9c1 (1pw9 C:235-355)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (22 proteins)

6. Protein Surfactant protein, lectin domain [56461] (2 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (3 PDB entries)

8. Domain d1pw9c1: 1pw9 C:235-355 [95209]
   Other proteins in same PDB: d1pw9a2, d1pw9b2, d1pw9c2
   complexed with ca

Details for d1pw9c1

PDB Entry: 1pw9, 1.6 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d

SCOP Domain Sequences for d1pw9c1:

Sequence; same for both SEQRES and ATOM records:

>d1pw9c1 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d1pw9c1:

• d1pw9c1 is new in SCOP 1.67
  
• d1pw9c1 appears in SCOP 1.69
  
• d1pw9c1 appears in the current release, SCOPe 2.08