SCOP 1.67: Domain d1pw9a2: 1pw9 A:205-234

Lineage for d1pw9a2 (1pw9 A:205-234)

1. Root: SCOP 1.67

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (2 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (4 PDB entries)

8. Domain d1pw9a2: 1pw9 A:205-234 [95206]
   Other proteins in same PDB: d1pw9a1, d1pw9b1, d1pw9c1

Details for d1pw9a2

PDB Entry: 1pw9, 1.6 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d

SCOP Domain Sequences for d1pw9a2:

Sequence; same for both SEQRES and ATOM records:

>d1pw9a2 h.1.1.1 (A:205-234) Surfactant protein {Human (Homo sapiens), SP-D}
aslrqqvealqgqvqhlqaafsqykkvelf

Timeline for d1pw9a2:

• d1pw9a2 is new in SCOP 1.67
  
• d1pw9a2 appears in SCOP 1.69
  
• d1pw9a2 appears in the current release, SCOPe 2.08