Lineage for d1pw5a_ (1pw5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920095Family c.108.1.14: NagD-like [102317] (7 proteins)
    duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family
  6. 2920099Protein Hypothetical protein TM1742 [102318] (1 species)
    putative NagD protein
  7. 2920100Species Thermotoga maritima [TaxId:2336] [102319] (2 PDB entries)
  8. 2920102Domain d1pw5a_: 1pw5 A: [95199]
    structural genomics,
    complexed with ndg, so4

Details for d1pw5a_

PDB Entry: 1pw5 (more details), 2.8 Å

PDB Description: putative nagd protein
PDB Compounds: (A:) nagD protein, putative

SCOPe Domain Sequences for d1pw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pw5a_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]}
mldkielfildmdgtfylddsllpgslefletlkeknkrfvfftnnsslgaqdyvrklrn
mgvdvpddavvtsgeitaehmlkrfgrcrifllgtpqlkkvfeayghvideenpdfvvlg
fdktltyerlkkacillrkgkfyiathpdincpskegpvpdagsimaaieastgrkpdli
agkpnplvvdvisekfgvpkermamvgdrlytdvklgknagivsilvltgettpedlera
etkpdfvfknlge

SCOPe Domain Coordinates for d1pw5a_:

Click to download the PDB-style file with coordinates for d1pw5a_.
(The format of our PDB-style files is described here.)

Timeline for d1pw5a_: