PDB entry 1pw5

View 1pw5 on RCSB PDB site
Description: putative nagD protein
Class: structural genomics, unknown function
Keywords: nagD protein, T. maritima, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-06-30, released 2004-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nagD protein, putative
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1742
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X264 (0-252)
      • modified residue (0)
      • modified residue (11)
      • modified residue (60)
      • modified residue (80)
      • modified residue (165)
      • modified residue (202)
      • modified residue (204)
    Domains in SCOPe 2.08: d1pw5a_
  • Heterogens: NDG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pw5A (A:)
    mldkielfildmdgtfylddsllpgslefletlkeknkrfvfftnnsslgaqdyvrklrn
    mgvdvpddavvtsgeitaehmlkrfgrcrifllgtpqlkkvfeayghvideenpdfvvlg
    fdktltyerlkkacillrkgkfyiathpdincpskegpvpdagsimaaieastgrkpdli
    agkpnplvvdvisekfgvpkermamvgdrlytdvklgknagivsilvltgettpedlera
    etkpdfvfknlge