SCOPe 2.02: Domain d1pvhd_: 1pvh D:

Lineage for d1pvhd_ (1pvh D:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Leukemia inhibitory factor (LIF) [47274] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63529] (3 PDB entries)

8. Domain d1pvhd_: 1pvh D: [95170]
   Other proteins in same PDB: d1pvha1, d1pvha2, d1pvhc1, d1pvhc2
   complexed with iod

Details for d1pvhd_

PDB Entry: 1pvh, 2.5 Å

PDB Description: Crystal structure of leukemia inhibitory factor in complex with gp130

PDB Compounds: (D:) leukemia inhibitory factor

SCOPe Domain Sequences for d1pvhd_:

Sequence; same for both SEQRES and ATOM records:

>d1pvhd_ a.26.1.1 (D:) Leukemia inhibitory factor (LIF) {Human (Homo sapiens) [TaxId: 9606]}
cairhpchnnlmnqirsqlaqlngsanalfilyytaqgepfpnnldklcgpnvtdfppfh
angtekaklvelyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlc
rlcskyhvghvdvtygpdtsgkdvfqkkklgcqllgkykqiiavlaqaf

Timeline for d1pvhd_:

• d1pvhd_ first appeared in SCOP 1.67
  
• d1pvhd_ appears in SCOPe 2.01
  
• d1pvhd_ appears in SCOPe 2.03
  
• d1pvhd_ appears in the current release, SCOPe 2.08