| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.1: Long-chain cytokines [47267] (9 proteins) |
| Protein Leukemia inhibitory factor (LIF) [47274] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63529] (2 PDB entries) |
| Domain d1pvhd_: 1pvh D: [95170] Other proteins in same PDB: d1pvha1, d1pvha2, d1pvhc1, d1pvhc2 complexed with iod |
PDB Entry: 1pvh (more details), 2.5 Å
SCOP Domain Sequences for d1pvhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvhd_ a.26.1.1 (D:) Leukemia inhibitory factor (LIF) {Human (Homo sapiens)}
cairhpchnnlmnqirsqlaqlngsanalfilyytaqgepfpnnldklcgpnvtdfppfh
angtekaklvelyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlc
rlcskyhvghvdvtygpdtsgkdvfqkkklgcqllgkykqiiavlaqaf
Timeline for d1pvhd_: