Lineage for d1pvhc1 (1pvh C:101-196)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 366660Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 366661Family b.1.2.1: Fibronectin type III [49266] (22 proteins)
  6. 366674Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 366675Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 366685Domain d1pvhc1: 1pvh C:101-196 [95168]
    Other proteins in same PDB: d1pvhb_, d1pvhd_

Details for d1pvhc1

PDB Entry: 1pvh (more details), 2.5 Å

PDB Description: Crystal structure of leukemia inhibitory factor in complex with gp130

SCOP Domain Sequences for d1pvhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvhc1 b.1.2.1 (C:101-196) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
glppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsc
tvdystvyfvnievwveaenalgkvtsdhinfdpvy

SCOP Domain Coordinates for d1pvhc1:

Click to download the PDB-style file with coordinates for d1pvhc1.
(The format of our PDB-style files is described here.)

Timeline for d1pvhc1: