SCOPe 2.05: Domain d1pu9a_: 1pu9 A:

Lineage for d1pu9a_ (1pu9 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species)

7. Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries)
   Uniprot Q27198 49-209

8. Domain d1pu9a_: 1pu9 A: [95129]
   complex with coenzyme A and histone H3 peptide, chain B
   complexed with coa

Details for d1pu9a_

PDB Entry: 1pu9, 2.3 Å

PDB Description: Crystal Structure of Tetrahymena GCN5 with Bound Coenzyme A and a 19-residue Histone H3 Peptide

PDB Compounds: (A:) hat a1

SCOPe Domain Sequences for d1pu9a_:

Sequence; same for both SEQRES and ATOM records:

>d1pu9a_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}
lldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvi
ggicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaig
yfkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

Timeline for d1pu9a_:

• d1pu9a_ first appeared in SCOP 1.67
  
• d1pu9a_ appears in SCOPe 2.04
  
• d1pu9a_ appears in SCOPe 2.06
  
• d1pu9a_ appears in the current release, SCOPe 2.08