PDB entry 1pu9

View 1pu9 on RCSB PDB site
Description: Crystal Structure of Tetrahymena GCN5 with Bound Coenzyme A and a 19-residue Histone H3 Peptide
Class: transferase/structural protein
Keywords: histone acetyltransferase, gcn5-related n-acetyltransferase, coa-binding protein, ternary complex, transferase/structural protein complex
Deposited on 2003-06-24, released 2003-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hat a1
    Species: Tetrahymena thermophila [TaxId:5911]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27198 (0-162)
      • see remark 999 (42)
      • see remark 999 (162)
    Domains in SCOPe 2.05: d1pu9a_
  • Chain 'B':
    Compound: histone h3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pu9A (A:)
    lldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvi
    ggicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaig
    yfkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr
    

  • Chain 'B':
    No sequence available.