Lineage for d1pu9a_ (1pu9 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416835Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 416836Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 416837Family d.108.1.1: N-acetyl transferase, NAT [55730] (18 proteins)
  6. 416859Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (2 species)
  7. 416863Species Tetrahymena thermophila [TaxId:5911] [55739] (7 PDB entries)
  8. 416869Domain d1pu9a_: 1pu9 A: [95129]
    complex with coenzyme A and histone H3 peptide, chain B
    complexed with coa

Details for d1pu9a_

PDB Entry: 1pu9 (more details), 2.3 Å

PDB Description: Crystal Structure of Tetrahymena GCN5 with Bound Coenzyme A and a 19-residue Histone H3 Peptide

SCOP Domain Sequences for d1pu9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pu9a_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila}
lldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvi
ggicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaig
yfkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

SCOP Domain Coordinates for d1pu9a_:

Click to download the PDB-style file with coordinates for d1pu9a_.
(The format of our PDB-style files is described here.)

Timeline for d1pu9a_: