SCOP 1.75: Domain d1pqvf_: 1pqv F:

Lineage for d1pqvf_ (1pqv F:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)

8. Domain d1pqvf_: 1pqv F: [95033]
   complexed with transcription elongation factor S-II

Details for d1pqvf_

PDB Entry: 1pqv, 3.8 Å

PDB Description: RNA polymerase II-TFIIS complex

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOP Domain Sequences for d1pqvf_:

Sequence; same for both SEQRES and ATOM records:

>d1pqvf_ i.8.1.1 (F:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d1pqvf_:

• d1pqvf_ first appeared in SCOP 1.67
  
• d1pqvf_ appears in SCOP 1.73
  
• d1pqvf_ appears in SCOPe 2.01
  
• d1pqvf_ appears in the current release, SCOPe 2.08