Lineage for d1pqvf_ (1pqv F:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 433235Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 433236Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 433237Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 433238Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 433239Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (5 PDB entries)
  8. 433245Domain d1pqvf_: 1pqv F: [95033]

Details for d1pqvf_

PDB Entry: 1pqv (more details), 3.8 Å

PDB Description: RNA polymerase II-TFIIS complex
PDB Compounds: (F:)

SCOP Domain Sequences for d1pqvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqvf_ i.8.1.1 (F:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae)}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOP Domain Coordinates for d1pqvf_:

Click to download the PDB-style file with coordinates for d1pqvf_.
(The format of our PDB-style files is described here.)

Timeline for d1pqvf_: