| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (16 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
| Protein Class delta GST [81366] (5 species) formerly a part of class theta enzymes |
| Species African malaria mosquito (Anopheles gambiae), isozyme 1-6 [TaxId:7165] [102441] (1 PDB entry) |
| Domain d1pn9b2: 1pn9 B:1-83 [94952] Other proteins in same PDB: d1pn9a1, d1pn9b1 complexed with gtx |
PDB Entry: 1pn9 (more details), 2 Å
SCOP Domain Sequences for d1pn9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pn9b2 c.47.1.5 (B:1-83) Class delta GST {African malaria mosquito (Anopheles gambiae), isozyme 1-6}
mdfyylpgsapcravqmtaaavgvelnlkltdlmkgehmkpeflklnpqhciptlvdngf
alwesraiqiylaekygkddkly
Timeline for d1pn9b2: