Lineage for d1pn9b2 (1pn9 B:1-83)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486664Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 486777Protein Class delta GST [81366] (5 species)
    formerly a part of class theta enzymes
  7. 486778Species African malaria mosquito (Anopheles gambiae), isozyme 1-6 [TaxId:7165] [102441] (1 PDB entry)
  8. 486780Domain d1pn9b2: 1pn9 B:1-83 [94952]
    Other proteins in same PDB: d1pn9a1, d1pn9b1

Details for d1pn9b2

PDB Entry: 1pn9 (more details), 2 Å

PDB Description: Crystal structure of an insect delta-class glutathione S-transferase from a DDT-resistant strain of the malaria vector Anopheles gambiae

SCOP Domain Sequences for d1pn9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn9b2 c.47.1.5 (B:1-83) Class delta GST {African malaria mosquito (Anopheles gambiae), isozyme 1-6}
mdfyylpgsapcravqmtaaavgvelnlkltdlmkgehmkpeflklnpqhciptlvdngf
alwesraiqiylaekygkddkly

SCOP Domain Coordinates for d1pn9b2:

Click to download the PDB-style file with coordinates for d1pn9b2.
(The format of our PDB-style files is described here.)

Timeline for d1pn9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pn9b1