Lineage for d1pn9a2 (1pn9 A:1-83)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584834Protein Class delta GST [81366] (5 species)
    formerly a part of class theta enzymes
  7. 584835Species African malaria mosquito (Anopheles gambiae), isozyme 1-6 [TaxId:7165] [102441] (1 PDB entry)
  8. 584836Domain d1pn9a2: 1pn9 A:1-83 [94950]
    Other proteins in same PDB: d1pn9a1, d1pn9b1

Details for d1pn9a2

PDB Entry: 1pn9 (more details), 2 Å

PDB Description: Crystal structure of an insect delta-class glutathione S-transferase from a DDT-resistant strain of the malaria vector Anopheles gambiae

SCOP Domain Sequences for d1pn9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn9a2 c.47.1.5 (A:1-83) Class delta GST {African malaria mosquito (Anopheles gambiae), isozyme 1-6}
mdfyylpgsapcravqmtaaavgvelnlkltdlmkgehmkpeflklnpqhciptlvdngf
alwesraiqiylaekygkddkly

SCOP Domain Coordinates for d1pn9a2:

Click to download the PDB-style file with coordinates for d1pn9a2.
(The format of our PDB-style files is described here.)

Timeline for d1pn9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pn9a1